SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0087481 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087481
Domain Number 1 Region: 70-200,284-372
Classification Level Classification E-value
Superfamily alpha/beta knot 6.54e-52
Family Hypothetical protein MTH1 (MT0001), dimerisation domain 0.0018
Further Details:      
 
Domain Number 2 Region: 184-265
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.05e-16
Family Hypothetical protein MTH1 (MT0001), insert domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087481   Gene: FBgn0033473   Transcript: FBtr0088393
Sequence length 485
Comment pep:known chromosome:BDGP5:2R:5914346:5916003:1 gene:FBgn0033473 transcript:FBtr0088393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTMLAAPTASSNGRPIGPHKSWKKVNEERKALKRQRKQDKLLKELQQAKEAESQAGKAA
NEVQAKDKPNPSTLSIAVPGSILENAQSNELRAYVAGQIARAACIFRVNEVIVFDDVGIA
TARETKRSYEADGEGSSTGTVRSSSLQLARILQYLECPQYLRKYFFPLHKDLKYSGLLNP
LDTPHHLRQQSKFRYREGVICDKKAKEGHSYANVGLLNDVLVDKAIEPGVRVTVKMEPQS
ESCRKQRGTLVSPDEPRRETGVYWGYQVRIAHSMSEIFTKSPYATGYDVTVGTSDRGTNV
HEVPNRSYNFNHMLIVFGGLQGLESALANDEKLTVDDPELLFDHYVNVLPRQGSRTIRTE
EALLIALAALQEKLQPQVADVEIDLTDLLPKSEDSGIAVRRDVLVSKKQKKRKQVEDTPD
ETVVDEPSFSKPLPKVARLTANPFADSSEELAKNTPAQDDFEVVSSTTVSGTSHSCADDD
LSRFD
Download sequence
Identical sequences A1Z830
FBpp0087481 7227.FBpp0087481 FBpp0087481 FBpp0087481 NP_610543.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]