SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0087625 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087625
Domain Number 1 Region: 224-261,468-546
Classification Level Classification E-value
Superfamily SET domain 9.94e-18
Family Viral histone H3 Lysine 27 Methyltransferase 0.057
Further Details:      
 
Domain Number 2 Region: 256-303
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000209
Family MYND zinc finger 0.09
Further Details:      
 
Domain Number 3 Region: 66-165
Classification Level Classification E-value
Superfamily TPR-like 0.000038
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087625   Gene: FBgn0033427   Transcript: FBtr0088542
Sequence length 751
Comment pep:known chromosome:BDGP5:2R:5469261:5472050:-1 gene:FBgn0033427 transcript:FBtr0088542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLARTFSQQNELITLNENYKDEFETFKSLASMPADILQIFQKLALDLLQDLEQPVDRK
GCAERSKNLREEGNLMFKESASGSSKDSVLKACRLYSEAVFEAENAVEELSLAFANRGIA
LQEYGYYREAYDDCSNALECGYPERLRHKVIMRQAFCAWKLKKIASLEEHLDYLGQLQLK
ESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEILTDPGPRGRYMVAKEAISKGNV
IFSERASCFVPLEQLLICQQCAATLMSAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAA
YRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYL
RSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASIEDWQLIISALIL
RFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAINLP
YLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHPLKAIY
KFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAEKPITC
TVCHELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAEELVTAC
FYEIDGGTSLDEFEYEDLARIIRKQLEGIAAQCGDNSTEYIARMTYLWDIIAQKKCRTDR
KELLEMKGKVDYLASEHREVFLNYYNDFIEQ
Download sequence
Identical sequences A1Z7W1
FBpp0087625 FBpp0087625 7227.FBpp0087625 NP_610500.2.81976 NP_724802.1.81976 FBpp0087625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]