SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0087757 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087757
Domain Number 1 Region: 162-319
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-47
Family Myf domain 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087757   Gene: FBgn0033351   Transcript: FBtr0088676
Sequence length 323
Comment pep:known chromosome:BDGP5:2R:4814519:4815605:-1 gene:FBgn0033351 transcript:FBtr0088676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRAATTVGSACKNYGQNCSKFARNKRTMADLQQIASNNERAEALINSIEAEISGIQQQ
LVERQKQELIKENAALAKEVEAALAQLVQLELRNGKKQIPVPGARGFCTSAAPVVMPAEA
GPATAAPAAPAPKPAKEPKEKKSKEKKPAAEKPAAAPEAPVDVGRLDLRVGKIVEVGRHP
DADSLYLEKIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMC
ASTPEKVEVLSPPAGAVPGDLVHCEGYPRQPDAQLNPKKKIFESCAPDLKTNGELVACYK
GAALHVPGKGNVVAQTLKNVNVK
Download sequence
Identical sequences A1Z7K8
FBpp0087757 FBpp0087757 FBpp0087757 7227.FBpp0087757 NP_610426.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]