SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0088055 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088055
Domain Number 1 Region: 168-421
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.39e-67
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 470-781
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.3e-42
Family Extended AAA-ATPase domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088055   Gene: FBgn0015929   Transcript: FBtr0088982
Sequence length 866
Comment pep:known chromosome:BDGP5:2R:3384207:3387394:-1 gene:FBgn0015929 transcript:FBtr0088982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPARSPSVGGATPKQGARTPTRGIASQDVETPMRMGPGRAVRPSDNISLPPTSPGNIS
LPATSPARGLGANMSEIDLSSPLNYGTPSSMGSIRTPRSGIRGTPLRARPDIRTDKRIRQ
VAIGGGSGLEPIPEKGSETTDPVSESSQAPQLVVWGTNVVVSQCKSKFKSFIMRFIDPSA
EQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGF
DMAINEMFFERYPAALLEHQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIP
EMREAFFSCNICSFSTTVEVDRGRINQPTLCTNCNTNHCFRLIHNRSEFTDKQLVKLQES
PDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVD
VVHFRKVDNKRLYEDEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKK
GILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGS
SAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSI
AKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIF
DKRLASHLVSLYYVTRHEEEDTMFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMR
KVGAGRGQISAYPRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPLS
GKIDVGILTTGLSTAARKKRADLVAAIKENLKKKGKVLTVPYQKLFSDIKEGSQIMITRE
QFEDALKEVQDEGAIVVMGKNTIRIC
Download sequence
Identical sequences A0A0B4LEV2 Q26454
NP_001286160.1.81976 NP_477185.1.81976 FBpp0088055 FBpp0088055 FBpp0088055 FR557 7227.FBpp0088055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]