SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0100023 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0100023
Domain Number 1 Region: 129-219
Classification Level Classification E-value
Superfamily TPR-like 1.25e-17
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0100023   Gene: FBgn0036793   Transcript: FBtr0100567
Sequence length 435
Comment pep:known chromosome:BDGP5:3L:18593250:18594953:-1 gene:FBgn0036793 transcript:FBtr0100567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFHFVVVTACLGFQVKGEVVSAPESYDFAISSESQLSLLKLKETHVNNLQSYKKVLKKH
LQKIRRLLKKDLGLEQIAVSQMLLTQQPTSVDFEESMGAMHRLQTVYNLDSYAMTEGFID
DKDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELALYHYDDNVSPEVLKIKLWNYPNL
LESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLKHLQSNPAKLTKPKKVFQL
QKEICSKRYRRKSGVLVCRYVDWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKN
VSRPKLQRIEHLSGNCSCKIGNLSTSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIA
GNYNPEEPKIHNKANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENLKKSLIYHQC
PILKGNMWVANKVLN
Download sequence
Identical sequences FBpp0100023 FBpp0074877 7227.FBpp0074877 FBpp0074877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]