SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0110448 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110448
Domain Number 1 Region: 31-155
Classification Level Classification E-value
Superfamily HCP-like 1.83e-17
Family HCP-like 0.00042
Further Details:      
 
Domain Number 2 Region: 127-159,192-248
Classification Level Classification E-value
Superfamily HCP-like 7.59e-17
Family HCP-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110448   Gene: FBgn0039965   Transcript: FBtr0111192
Sequence length 266
Comment pep:known chromosome:BDGP5:X:22415347:22417005:1 gene:FBgn0039965 transcript:FBtr0111192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYDLKKESDVKEYVEKLGVEYRFGCYSEKKPEACHLLGDYLEGIKKDFEKASKVYKSTC
DDYGYAKSCYKYGNYSFLGKGKSGSKGNPQVAYEYYEKGCNLNDSDACLHSGLLLVSKSM
PREIDWNVPKGLEFLTKSCDLNNATACFYLSGMHISGVQKKADQSAVTASSGSGTSSPPA
GQPPLKDSDYIVLKDMKKAFQFAHKACELRNMYACANLSQMYARGDGIEKNEKEAEKYKK
LALEMQDEVKKQHDTLGFQQGVGMPN
Download sequence
Identical sequences Q9W5N0 X2JEN8
7227.FBpp0110448 NP_001036323.1.81976 NP_001285541.1.81976 FBpp0110448 FBpp0110448 FBpp0110448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]