SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0111383 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111383
Domain Number 1 Region: 127-238
Classification Level Classification E-value
Superfamily TPR-like 8.35e-16
Family Tetratricopeptide repeat (TPR) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111383   Gene: FBgn0085303   Transcript: FBtr0112469
Sequence length 250
Comment pep:known chromosome:BDGP5:3R:11557468:11558416:1 gene:FBgn0085303 transcript:FBtr0112469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLTTNTVDKKNEHEKPFGLEIPKPELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENA
NKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPD
DRVLAREQREDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKL
REFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFEYSVDRARRFNRSDADFID
EFLDKMRSLL
Download sequence
Identical sequences A2VEQ2
NP_001097807.1.81976 7227.FBpp0111383 FBpp0111383 FBpp0111383 FBpp0111383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]