SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0111406 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111406
Domain Number 1 Region: 117-221
Classification Level Classification E-value
Superfamily TPR-like 2.61e-19
Family Tetratricopeptide repeat (TPR) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111406   Gene: FBgn0085326   Transcript: FBtr0112493
Sequence length 233
Comment pep:known chromosome:BDGP5:3R:2572814:2573685:-1 gene:FBgn0085326 transcript:FBtr0112493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSLQHPQIDECFLDSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFII
TERKTPIPVISAPTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQ
NFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVL
NKLDEKNLRAWMYRAMAYKGLNDESNFENCVKYARKFNSKQMDFIDDFLEKLK
Download sequence
Identical sequences A8JQU5
FBpp0111406 7227.FBpp0111406 FBpp0111406 FBpp0111406 NP_001097696.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]