SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0111465 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0111465
Domain Number - Region: 180-219
Classification Level Classification E-value
Superfamily TPR-like 0.0607
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111465   Gene: FBgn0085374   Transcript: FBtr0112553
Sequence length 504
Comment pep:known chromosome:BDGP5:2L:6623123:6625361:1 gene:FBgn0085374 transcript:FBtr0112553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRSFHYILLNWILLFLFTVCKAKKAENDVVQEVIYSNSIRALSELREIENSYMEHLNN
YVSFLQQKIKTLRIFINSLTPNYLDHKVDRYKYVSNPLNSFGLLRRAHQDWPKLIAYLKD
QGNIKVDIEEMNKLINRTPHANDMEEALMGMDRIEHFYDLKSSDMAQGLVAGQQLSSRMS
ASDCLALADYMYKRSEFRRAAEWYRIALSVFTKPKNNIAFKFYAPKRKELEKMFVISRLQ
EGSVENLTDCLKELSQDPNNSLVHLRPRKSPTMIEQGCQGKFPPGPQLVCRYNSTTTPFM
RIAPLKEEEISRDPLIWLYHDVIYDSEIAQLTNVTREEMILGTTTNYTTPDRVNRLFHIK
VTDDDGGKLDKTLVNRMADISGLDVGNTTTLARINYGLGGYFQEHSDYMDIKLYPELTEE
GDRLMTFLFYMTDVPVGGTTIFPGAQLAIQPKKGSALFWYNLHNNGDPNLLTRHAVCPTI
VGSRWVLVKSMLNYEQMFKKPCYK
Download sequence
Identical sequences A8DYR4
FBpp0111465 FBpp0111465 FBpp0111465 7227.FBpp0111465 NP_001097101.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]