SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0289328 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289328
Domain Number 1 Region: 53-259,300-486
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000129
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289328   Gene: FBgn0052201   Transcript: FBtr0300051
Sequence length 520
Comment pep:known chromosome:BDGP5:3L:18602720:18604962:1 gene:FBgn0052201 transcript:FBtr0300051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKYHSLLPVLLGFAVLNSFVGCVEDIEEKERYSSSTVGLLKLLKVEEKFTDNLLNQVDQ
LGEKFEALRMYLSSVGYELHRSLNEKVQYVSNPINAFSLLRRTHEDLPKWHEYFKEAIGE
GNQSILVDLVKMVPNDVDMLSAMHGIQRIEKIYDLKIDDLAQGVLQGVQYNVQLTYRDLI
AMGNSMYQQSDYQTAAKWYRIACKRELENPEQLFIQILGDPSEHLHRQYIKSLFKYGSTT
SEPSKSIEEAFIMVQASQEELDNIMSDLNEPQNDVEVEKDLYQVKRSPSNCELGCRGLYR
QKTNLVCRYKSTANTFLRLAPLKLEEISLDPFMAMYHEVLYDSEIRELKGQSMNMVNGYA
SQRNGTEIRDTVVRYDWWSNTSLVRERINQRIIDMTGFNFLKDEKLQIANYGLGTYFQPH
FDYSSDGFETPNITTLGDRLASILFYASEVPQGGATVFPEINVTVFPQKGSMLYWFNLHD
DGKPDIRSLHSVCPVLNGDRWTLTKWVPMFPQMFSFPCKS
Download sequence
Identical sequences Q8IQS7
FBpp0289328 7227.FBpp0289328 NP_730346.2.81976 FBpp0289328 FBpp0289328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]