SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0289329 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0289329
Domain Number - Region: 162-221
Classification Level Classification E-value
Superfamily TPR-like 0.0126
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289329   Gene: FBgn0036796   Transcript: FBtr0300052
Sequence length 470
Comment pep:known chromosome:BDGP5:3L:18600562:18602612:1 gene:FBgn0036796 transcript:FBtr0300052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDNSGESEYVENNSVYSSITRLLKLLEMEEIFITNIKAYTNKLAEKVKNLQAYIDSVDY
EFQQSFEDREKYVGNPINAFSLVRRTHQDLPKWHNYSQQIVGMEELFALEEIIAKVPDKK
DMAYSLGEMHRIEQIYDLEAIELARGRIQGKQYDFRPSIRDCVALGEHKFKREDYQRASM
WFRVAIKHEPEGNAEIINSILGDPKVNLYTLYAKSMLIFGMIKSNPSMTIAEAKKISYEA
LNKASLADIKSLLNELLSQTDDEIVYEMNVNKTKPSDYEIGCRGQFLRRRNHVCTYNFTI
TEFLKLAPLKQEVLNWDPYIVIYHDVLNDDEIDKLKNHLNDTDAVEVNPIEKRIFQRINE
LTRLSFEHSDQQIVSKNGPRTHKHKKEYLKGTLLFFLNNVELGGAMVFPKLKISVFPQKG
SCLFWHNTLDPRSEPLECPVLQGNKRVITQKGAYNGRPMQYKKAKSNQKF
Download sequence
Identical sequences Q9VVQ7
FBpp0289329 7227.FBpp0289329 NP_649045.2.81976 FBpp0289329 FBpp0289329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]