SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0289484 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289484
Domain Number 1 Region: 590-901
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-81
Family Protein kinases, catalytic subunit 0.0000315
Further Details:      
 
Weak hits

Sequence:  FBpp0289484
Domain Number - Region: 1239-1300
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00035
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Domain Number - Region: 263-344,380-417
Classification Level Classification E-value
Superfamily TPR-like 0.00872
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289484   Gene: FBgn0014006   Transcript: FBtr0300256
Sequence length 1363
Comment pep:known chromosome:BDGP5:3R:15705441:15711752:1 gene:FBgn0014006 transcript:FBtr0300256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVVCVMDTAVGDHLEDRQCALEEIKQAVQSAGANFQRVQFERLDFGETNVLETFYNADV
AIIDLSILTQQRPLSYHYGVRESFGMKENILTYNDIDSKQTLSLKLSCANYLFLSYKRNA
ETNSCHLTSQPNSGNNSKEPNAEGRVPTLQWRLKRKLQDVEIQSKAHMREKFLSDMRTAR
DTYATNGAKLQSILHEMRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPN
TRKYVETGNMSFLYAFALNRRNRKGDREKALESSLKALEKKENHFPDMLCLCGRIYKDIF
VESDYTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFTNTEELQHIGMTLNN
LIGKKGSLSSLSEYWDVATFFEISVLANDYAKAIQAAECMFKLKPPNWYLKSTIGNISLI
HRFRKKPEERQPPIEEQVFQFWMDFFLEATNTEEVKNSIRFPILILEPQKIYMPSYVTIN
MDADEKSIQIVNICLAHAKNACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQ
IYFPSTERRQKFYDMILEMTADQVVFVNLSNDDANIEYEYDYDEQNRKMVLGKGTYGTVY
AARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSCSENGFFKIFME
QVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYS
GVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMA
TGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLED
PFLQDKPRKVRPALPINTEFGRSISVPADRFVHKTTPPLSYNTTCNTPTTPELDITHSSS
VDIDELPSNQFMLERRNSHGFLLSPEIEPSTPSLRTSISETSETDGFYRLKKDSQRRTTL
SKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVLIRGLRDYIMNENEKHLEATINELK
QKLNNDAVALDHLHLALYSFQDAVVCVLRYHCIKPHWMFALDNLVKRAVQAAVTIFSPEL
GANLADKDLSGNDDESLRTSLMQKGSTESQEKQSLEKVLPTSNTREGVGLTPAESGGDAL
SSSMECARILRDIRDNQQKLQRQLLEQQRQSMRALHNISQELAHIYMGGRKRLRRTINGF
NKKCHRMSTSVGGTSGVRPNIAGNPRRQLNKHHFGLHEVDEQLEQWLTQQEIDEFSKTLI
LNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKLIIQERVCTSSDCVDSPPSTYHKPIG
GNSSFALIDNNNTLPSPTTTTPGTPGIKTKIKKSESEYDSCSE
Download sequence
Identical sequences Q9VDS9
7227.FBpp0289484 FBpp0289484 NP_477089.3.81976 FBpp0289484 FBpp0289484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]