SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0290205 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0290205
Domain Number - Region: 133-218
Classification Level Classification E-value
Superfamily TPR-like 0.00104
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290205   Gene: FBgn0051021   Transcript: FBtr0300983
Sequence length 453
Comment pep:known chromosome:BDGP5:3R:26427928:26429763:1 gene:FBgn0051021 transcript:FBtr0300983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNLERNLLQNMRDYAEKLEEKIDLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRH
MHQDWVGWQVYMEDLVAPEAVQKVESLLPQLPQKEAFRKAARSVHSLTQFYGYEPADLVA
KDERSSSLHLSPLDCYHLGLELYEEQDYLGAAKWLQVAAHNYTLSRHRDLFNPLGAPRWQ
VYRDLGRTLLKLNRQCAYDAYESALRLNSQNVHLMKEAGQMELFSLRDPMEPILDLQPKP
TVLEKYCRGEVPRHQGRLTCELNDWVHSFLAYAPIKFEDLQQDPFIILYPGSIYEQEIRH
VENAYERCPPNDRFELKLGISGCSISDGYSPVLKRINERILDMAGVEKTWDTFYIVEYAQ
LAPFEPFKLFRNSTKFPKLNLMNFEDVEAKVIIFLKDVTLGGAFTMPNGDILVQPKRGNV
LITFENEEHSTTICPIIEGTGLVMIKFIMKTDE
Download sequence
Identical sequences Q8IMH8
FBpp0290205 FBpp0290205 NP_733392.2.81976 FBpp0290205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]