SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0290580 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290580
Domain Number 1 Region: 49-100,157-193
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000122
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number 2 Region: 142-212,244-266,312-349,383-414
Classification Level Classification E-value
Superfamily TPR-like 0.00000000268
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 3 Region: 401-516
Classification Level Classification E-value
Superfamily TPR-like 0.000000544
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290580   Gene: FBgn0032470   Transcript: FBtr0301366
Sequence length 655
Comment pep:known chromosome:BDGP5:2L:13106871:13109468:1 gene:FBgn0032470 transcript:FBtr0301366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHQGIILREGHVTRTIYNLIKDKRYEDVIECITSFGEAANTRAGLSTLGHCYYHAQKYE
EAATCYEQLCQLAPKEAKYRFYYAQSLYQAGIFADALRVLKQMGDQEDELREQCLQLQSA
ILYSSEDFAGAQSLLNQRAGGTADTLNDEGCLLFQADQHEAAVQRFQAALQVGGFNPLVA
YNVALAHFQKKQRAQALDYTSEIVERGMRNHPELGIGAQMDIPDGGARSVGNPITMAISG
ITQALNLKAAIEFQDGNEEAARDALLDLPPRAESELDPVTLHNMALTDVEGPVAGLRKLA
FLLELGAPSCPKETFANILLICCKNELYETAADILAEHTDLTYKYLSQYLYELLDSLITA
QTSAELAEKKLGTLASSLAGKLRSLAAKVQEVRATNEQQALRDALKDYEQALELYLPVVM
ARAWISWRDDDFVGAEREFHASAEFCSENSIWRLNAGHVLFMQGDKYNEAAAFYEPIVRQ
HSDDIMSVSAAVLANLCVSYIMTFQNEEAEELMRKVEKAEEMKGNLGKQYHHLCIVNLVV
GTLYCAKSNYEFGLSRIAHALESGSGNRLYADTWLHVKHCILGLLTGMAKQNIILPYATV
QEVLNFLRFCESYGLFTPANIFSATEQVPEEPLTIGLEARKLRLLLIKLSEYDNF
Download sequence
Identical sequences M9PDD5 Q9VK41
NP_001097155.2.81976 NP_001260430.1.81976 FBpp0290580 FBpp0290580 FBpp0290580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]