SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0290600 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290600
Domain Number 1 Region: 335-415
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000057
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 269-332
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000144
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 
Weak hits

Sequence:  FBpp0290600
Domain Number - Region: 56-120
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0579
Family Cold shock DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290600   Gene: FBgn0028734   Transcript: FBtr0301386
Sequence length 729
Comment pep:known chromosome:BDGP5:3R:5927298:5934033:-1 gene:FBgn0028734 transcript:FBtr0301386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTGKSRELKAGQHQHQQQEGQGRTAKNHQNQNQNKADKPGGTTSGDMEDLLVEVRLDN
GAYYKGQVTAVADDGIFVDVDGVPESMKYPFVNVRLPPEETVEVAAPIFEEGMEVEVFTR
TNDRETCGWWVGIIKMRKAEIYAVAYIGFETSYTEICELGRLRAKNSNPPITAKTFYQFT
LPVPEELREEAQKDGIHKEFQRTIDAGVCNYSRDLDALIVISKFEHTQKRASMLKDMHFR
NLSQKVMLLKRTEEAARQLETTKLMSRGNYVEEFRVRDDLMGLAIGSHGSNIQAARTVDG
VTNIELEEKSCTFKISGETEESVQRARAMLEYAEEFFQVPRELVGKVIGKNGRIIQEIVD
KSGVFRIKIAGDDEQDQNIPRELAHVPFVFIGTVESIANAKVLLEYHLSHLKEVEQLRQE
KMEIDQQLRAIQESSMGSTQSFPVTRRSERGYSSDIESVRSMRGGGGGQRGRVRGRGGGG
PGGGNGLNQRYHNNRRDEDDYNSRGDHQRDQQRGYNDRGGGDNTGSYRGGGGGAGGPGNN
RRGGINRRPPRNDQQNGRDYQHHNHTTEEVRETREMSSVERADSNSSYEGSSRRRRRQKN
NNGPSNTNGAVANNNNKPQSAQQPQQQQPPAPGNKAALNAGDASKQNSGNANAAGGASKP
KDASRNGDKQQAGTQQQQPSQVQQQQAAQQQQPKPRRNKNRSNNHTDQPSGQQQLAENVK
KEGLVNGTS
Download sequence
Identical sequences A0A0B4K618
FBpp0290600 NP_001247017.1.81976 FBpp0300445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]