SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0290863 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290863
Domain Number 1 Region: 38-99
Classification Level Classification E-value
Superfamily TPR-like 0.0000000403
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Weak hits

Sequence:  FBpp0290863
Domain Number - Region: 22-107,215-321
Classification Level Classification E-value
Superfamily TPR-like 0.0135
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290863   Gene: FBgn0037502   Transcript: FBtr0301649
Sequence length 580
Comment pep:known chromosome:BDGP5:3R:3246487:3248779:1 gene:FBgn0037502 transcript:FBtr0301649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQMSLSEGLQAPIAGVQPHLQPWEAHAWSPDRLGSMYSDWAMFFFTQQRYANGLRYFN
SALDLNPFNERALMRRSQLKRSMGLASEALKDCSRAEDLLMSRKPPVTNPNVSLEVCDAL
YESNRLEDSKINLHCHLKRFSSGQRGPVLDRLNVLNENFHDTLSDDTTMSVQRLINRMMA
SLAKEPKDIKDTCDVVSIMENEETHLSPLEMARRKRHFKIYNQTYLNKCWVDVAFLKTLR
DDPNVLPKHCKKSSEYLGKLMASNYKAERTLTKTLHTRSPMYALHQQKYPNEAFYNKHRE
ENLYRIQYQTRRNMFKILRSIRLLIRVGELNKLTTFIEEVMGDYVTIKTNRVMPWKFEFT
NEVYNYLGLARINEYKIPSNMTVLQGKQRLLTLFRLPLSNSLDMKKSKTKRTSALNITRS
ATTDPKAEHFKKQVVRLENRMRFAEYHIERAYLLHELAQEHLNCNSFDGACSMARMALEE
AIKCKSVIWSFLSLMVICKAHAILGKIEREKEILAEAFELAKKMKNLDLCLFIDICIKVN
AEEMEMKRMVTTDLTAKRQKFGSKMFQSNDQVNEDRNQIT
Download sequence
Identical sequences Q9VIA6
FBpp0290863 NP_649721.2.81976 FBpp0290863 FBpp0290863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]