SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0291495 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291495
Domain Number 1 Region: 359-423
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000898
Family PCI domain (PINT motif) 0.05
Further Details:      
 
Weak hits

Sequence:  FBpp0291495
Domain Number - Region: 197-282
Classification Level Classification E-value
Superfamily HCP-like 0.00199
Family HCP-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291495   Gene: FBgn0261396   Transcript: FBtr0302289
Sequence length 494
Comment pep:known chromosome:BDGP5:2L:19051830:19053681:1 gene:FBgn0261396 transcript:FBtr0302289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNATDIGANDVEMEVDPTAETLADEKKNQDVAAVQEIREQIRQIEKGVASKESRFILRV
LRNLPNTRRKLNGVVFRNLAQSIYPAGADREAAVALMPAVEKDATELPDVPKKQVATKAP
IAEVDAYFYLLLLVKLIDASDLKRAGISADALMAKISIQNRRTLDLIGAKSYFYFSRVAE
LKNSLEGIRSFLHARLRTATLRNDFEGQAVLINCLLRNYLHYALYDQADKLVKKSVYPES
ASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQTVQKLIIVVELLL
GNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQLDHTFTLIIRLR
HNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAEDAEFIVSKAIRDGVIEATLDPAQNFMR
SKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKDLESAEERREREQQDL
ELAKEMAEDDEDGF
Download sequence
Identical sequences M9PG62 P25161
NP_001260557.1.81976 NP_477300.1.81976 7227.FBpp0080691 FBpp0291495 FBpp0291495 FBpp0291495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]