SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0292775 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292775
Domain Number 1 Region: 20-136,184-314,358-400
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.23e-24
Family WD40-repeat 0.016
Further Details:      
 
Domain Number 2 Region: 1005-1246
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000018
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Domain Number 3 Region: 363-412,482-681
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000151
Family WD40-repeat 0.022
Further Details:      
 
Domain Number 4 Region: 835-963
Classification Level Classification E-value
Superfamily TPR-like 0.00000854
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0292775
Domain Number - Region: 1220-1428
Classification Level Classification E-value
Superfamily TPR-like 0.000266
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292775   Gene: FBgn0260933   Transcript: FBtr0303763
Sequence length 1503
Comment pep:known chromosome:BDGP5:2L:553742:560310:-1 gene:FBgn0260933 transcript:FBtr0303763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLYFDTKIEFLDSDAVSTISSWHPSEPLFAVASFSPERGGSVTIFADTGEPQRDVTYPV
HATSQATALCWHPEKALLASGWEHGDIHVWFAGHREFASVNAPHKAAIVLLQFSEQGGRM
VTADAMGLVTGWRCDGQYQFLTMFSHDLREVLLLICFRLTVESEVREEMANLAKAAVAGD
ENALDTLTNWRPRTAARSMTHSGVRDNHCFYACTQGGVVYYINQGGACVEVMKCGSLPPI
VQMLWHPRKDAVICLMEDLTVTLFLVESTGILTELDRVKMSGRGGGRQGGIAWSGNSLAI
ITGDFFVRIWDIERSDNYLLKMDLPSGNQPGSSMTTLSNGTMSSSNQFFSHDSSESSGVL
RKTPKYGQLNGEMFTCLAYSSTGQTLCAGTSQGNVYTWKRSGSRLVGAPEDAWQLTNISS
VRGAIRSCEWGYNELAKPCMLVNCLSNVFMLKEQPLLAVHTRELWAVQRSAKSVQLTHCS
GREAIVQSEFAVTAMALSELSLVMSNGRSISSYSLQKVEKSLDEFEEILQTVEGTTPTTE
STTTPLSLKLLQTFAAECLALNLCNQNIFCLGSSDVFVYSVGGVVLHRIQASDIEGKIIG
MDLSGCYLSVFTMNGYVKAYDVSRHDPKLLFPSKSGHDIFDDFGEFILVKCNSSGSHLAM
VIASSNFTPISTLFCWDFERSNLLEYGLLEPETNAKKESSTSLPVRIFWDAEEPRLLATE
VKSMIQKTLPQKNSLQPSHFVQSKVVLLFYSEKGCLNVLETQSMSPGCQLLNLCVPNVIR
LKINTMEEQPLQDFVDLQQCNPVTRKQVLNFSLYVAEGNMDMAYRSIRSIQSKVIWTNLA
KMCVHTNRLDVAKVCMGHLEQARSVRALRQAIEDDDLETEAKVAVLAIELGMIEEAKDLY
RRCKRFDLLNKLLQSIGHLDEAVELAEAEDRIHLKHTYYQKAQELRERGDIKGALEYFEK
TQNPAQNITQLLLENPGAMKRYIQTTSDPKLLKWWGQYIESSGDMDAALAVYHKAEDWFS
QVKILCYLGKISKADAIARQSGDRAACYHLARHYENVGKFQEAIMFFTRAQTFSNAIRIC
KENDFQEELWTVASSSRQRDKAIAAAYFEECGNFKHAVELYHRAGMLHKALEMAFESQQP
EILEIIASDLAPDSDAELINRCADFFCSIEQFQKAVHLLAKTRHLERALGICSEKGVPVT
EELSEMLTPEKGEFEEATRVHILVQLGEFLQQQGDYHSATKKFTQAGDKIRAMKSLLKSG
NTDKIIFFANMSRQREVYIMAANYLQALDWQSDPQVLKHIVTFYTKGQAFDSLANFYAIC
AQIEIEEFQDYGKALTAMQEASKCLEKLSHAQHVYNNLQRTVADVKAILEIQQALREGDH
QLVIGSCRSMLIKPELPPIRHAHILAMLIRALVYVKDYSEAGRALKELTVKDSTWSASGL
LDRSIVHKIAQECHLEFDLIWNAGRQVTASTSGTAATGMSSTSGMTTTDDDDADDEEITE
ELH
Download sequence
Identical sequences Q7KTZ4
FBpp0292775 FR538 NP_995608.1.81976 FBpp0077738 7227.FBpp0077738 FBpp0077738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]