SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0293245 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0293245
Domain Number - Region: 175-224
Classification Level Classification E-value
Superfamily TPR-like 0.036
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293245   Gene: FBgn0036795   Transcript: FBtr0304702
Sequence length 515
Comment pep:known chromosome:BDGP5:3L:18598572:18600449:1 gene:FBgn0036795 transcript:FBtr0304702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNVVRAAAVLILVQSIHSTDPNDFLNRKYYSSSVLGLVKLLKMEQEFMVNFSIYANILQ
EKVDNLNIFLDALKRPNHKTHNEREKFVSNPLNAFGLIRRLNQDWPKLQNYTQKPLGLEQ
LTAMQDIVSAAPESFDMNEKLKAMHRIETTYDLQPKDIAKGLLQRTEFNYRLLFRDCLAL
AYHKFEIGEFKRSLLWFQEALKLSTDGSLEIMNRLKEIELKGFATAVAKRSIYLSNQGLT
NETIDDMANSQLQDAKLMDLEQLISSELKQWINDDSTTPPTDHNLGCRGLFPKKSNLVCR
YNSSTNAFLKLAPLKMEEISRDPYIVMFHEVISDKDIEEMKGEITEMENGWTSLGDPKEI
VSRVYWIRKESSFSKRINQRISDMTGFKLEEFPAIQLANFGVGGYFKPHYDFYTDRLKEV
DVNNTLGDRIGSIIFYAGEVSQGGQTVFPDLKVAVEPKKGNALFWFNAFDDSTPDPRSLH
SVCPVLVGSRWTITKWLHYAPQLFVKPCSPRVHLE
Download sequence
Identical sequences Q9VVQ6
FBpp0293245 FBpp0293245 NP_649044.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]