SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070402 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070402
Domain Number 1 Region: 66-508
Classification Level Classification E-value
Superfamily TPR-like 1.16e-77
Family HAT/Suf repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  FBpp0070402
Domain Number - Region: 520-618
Classification Level Classification E-value
Superfamily Ferritin-like 0.0953
Family Ferritin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070402   Gene: FBgn0000377   Transcript: FBtr0070418
Sequence length 702
Comment pep:known chromosome:BDGP5:X:2141627:2144015:-1 gene:FBgn0000377 transcript:FBtr0070418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPQKMPKVAKVKNKAPAEVQITAEQLLREAKERDLEILPPPPKQKISDPAELADYQQR
KRKTFEDNLRKNRMVVSHWIKYAQWEEQQQEIQRARSIWERALDNEHRNVTLWLKYAEME
MKNKQVNHARNLWDRAVTIMPRVNQFWYKYTYMEEMLENVAGARQVFERWMEWQPEEQAW
QTYVNFELRYKEIDRAREIYERFVYVHPDVKNWIKFARFEESHGFIHGSRRVFERAVEFF
GDDYIEERLFIAFARFEEGQKEHDRARIIYKYALDHLPKDRTQELFKAYTKHEKKYGDRA
GIEDVIVSKRKYQYEQEVAANPTNYDAWFDYLRLIEAEGDRDQIRETYERAISNVPPANE
KNFWRRYIYLWINYALYEELEAEDAERTRQIYKTCLELIPHKQFTFSKLWLLYAQFEIRC
KELQRARKALGLAIGMCPRDKLFRGYIDLEIQLREFERCRMLYEKFLEFGPENCVTWMKF
AELENLLGDTDRARAIFELAVQQPRLDMPELLWKAYIDFEVALGETELARQLYERLLERT
QHVKVWMSFAKFEMGLSHGDSGPDAELNVQLARRIYERANEMLRQLGDKESRVLLLEAWR
DFERDASDSQEMQKVMDKMPRRIKKRQKIVSDNGVEEGWEEVFDYIFPEDEMARPNLKLL
AAAKMWKTQKDNTVDDPPATAIASEPEPAADAAPADTTDSGD
Download sequence
Identical sequences P17886
FBpp0070402 NP_477118.1.81976 7290299___KOG1915 FBpp0070402 FBpp0070402 7227.FBpp0070402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]