SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0071288 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071288
Domain Number 1 Region: 247-589
Classification Level Classification E-value
Superfamily TPR-like 0.000000174
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 
Domain Number 2 Region: 92-225
Classification Level Classification E-value
Superfamily TPR-like 0.0000512
Family HAT/Suf repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071288   Gene: FBgn0030081   Transcript: FBtr0071353
Sequence length 602
Comment pep:known chromosome:BDGP5:X:8972856:8975091:-1 gene:FBgn0030081 transcript:FBtr0071353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEFIAEMQERLLPEYEQMKNYSVFTADQVREIVSRRERLFLKINKSHQSITDYLDFILY
EKHMHMTIVDKEKKMHVKLTGLKASIATRIMRLYREALAKFNHDRRLWSNWIKFSRKSNP
VEVAGIYEKMLLYHGDSPDLWVDAALWLYEFNRLNIDRVKDILLRGLQRHPDSEALNKCF
FDIMLKEAALASNERNLAENTLSEQDIKLERVEAVYRNSMANITQLDYFVKLLESCEDHQ
ELTGKLQRMIIDDMQEKFPREPGLWDLLAQRELRGFHLGDLEEEDLDTSDEEPASKKSRS
VNGRSLKRRIQLCVTVYKSAVEELQTTEMWNMYLDAMLALNSDGKTERILKQQCLADALQ
AGHRSQLMGVKHYATLRKMLCTAPSGREAAVTILTEALKNDSSVEMHELLLATHIQSDSE
PLIYELFNKIQKSMGSEALPLWRSVILYYRTRQDSLGARRLDEIYGLACKAAWPEFGELR
SDYLRYLWQERSVEEARKEYAKLAILPPMSLALHRQMVQLESSAAACDQASLKYWRMCYD
FMACYFGKTQPRVWVEYLAFERDHGEAKNISLLTQRALSTLEPQYVAAFEAERALAYVGA
SI
Download sequence
Identical sequences Q9W397
7227.FBpp0071288 FBpp0071288 FBpp0071288 FBpp0071288 NP_572520.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]