SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0071560 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071560
Domain Number 1 Region: 579-889
Classification Level Classification E-value
Superfamily TPR-like 2.47e-42
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 
Domain Number 2 Region: 475-581
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000124
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071560   Gene: FBgn0020312   Transcript: FBtr0071637
Sequence length 926
Comment pep:known chromosome:BDGP5:2R:17011233:17015995:-1 gene:FBgn0020312 transcript:FBtr0071637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTNPNPGIHQYAPSTLPREREREGATNSPQRNLLEFLCICVACIVCYYNSTQCGLVFDD
ISAIRDNKDLRPHTPLINVFLNDFWGTPMRKEQSHKSYRPLTVLTFRFNYLLHALEPFGY
HLVNLLLHLSVCLLWRRVCRLLLRQCAASGSNAISAPSSSSVSQLNTCAFVASLLFAVHP
VHTEAVTGVVGRAELLSSICFLAAFLSYAKSVGDSGCPRRTNWLTLFGCFGSCLLASMLC
KEQGITIAGICVVYELFVVHQLRPLHLCHFVLRLFDERTEQQSPKLANPSGIRRWSSSTL
WKRLSFLVGITLTLLVGRVYVMGSQLPIFTRFDNPASAADTPERQLTYGYLIYLNCWLLL
CPSLLCCDWTMGTVPLLQGFTDSRNITTLLTFLALGAMVAKTCFTRNLALSRTLIMCLGW
MVLPFLPASNLFFPVGFVVAERILYMPSMGYCLLVAYGFEQLQRRGSLSWQRFSQAALAI
LLLTHALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLYNNVGHALENEGKFEEALLYFQQA
VRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFI
NLANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLY
DNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRV
SRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLL
ADTKRPLDAVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHYDPHNTQ
GLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDYIGRHLQIVLARLQKINKLPESAPERK
LAYEDYDPLEFKLPQDRPTHKSRKRS
Download sequence
Identical sequences E2QCJ5 Q7K4B6
7227.FBpp0071560 FBpp0071560 FBpp0071561 FBpp0071560 FBpp0071561 FBpp0071560 NP_477246.2.81976 NP_726030.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]