SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0073131 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073131
Domain Number 1 Region: 32-509
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.24e-121
Family Pyridoxal-dependent decarboxylase 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073131   Gene: FBgn0004516   Transcript: FBtr0073275
Sequence length 510
Comment pep:known chromosome:BDGP5:3L:4074069:4088744:-1 gene:FBgn0004516 transcript:FBtr0073275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLNPNGYKLSERTGKLTAYDLMPTTVTAGPETREFLLKVIDVLLDFVKATNDRNEKVLD
FHHPEDMKRLLDLDVPDRALPLQQLIEDCATTLKYQVKTGHPHFFNQLSNGLDLISMAGE
WLTATANTNMFTYEIAPVFILMENVVLTKMREIIGWSGGDSILAPGGSISNLYAFLAARH
KMFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSDEHGKMITSEL
ERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLLMSR
KHRHPRFTGVERADSVTWNPHKLMGALLQCSTIHFKEDGLLISCNQMSAEYLFMTDKQYD
ISYDTGDKVIQCGRHNDIFKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIREQSDRFHL
ILEPECVNVSFWYVPKRLRGVPHDAKKEVELGKICPIIKGRMMQKGTLMVGYQPDDRRPN
FFRSIISSAAVNEADVDFMLDEIHRLGDDL
Download sequence
Identical sequences A0A0J9UE83 B3NG30 B4HTZ3 B4PHP0 M9PH99 P20228
FBpp0132769 FBpp0073131 NP_001261396.1.81976 NP_523914.2.81976 NP_728930.1.81976 NP_728931.1.81976 XP_001971833.1.56816 XP_002035278.1.34323 XP_002093637.1.41174 XP_015013328.1.56816 XP_015013329.1.56816 XP_015049678.1.41174 XP_015049679.1.41174 XP_016030326.1.80810 XP_016030327.1.80810 XP_016030328.1.80810 XP_016965944.1.21709 XP_016965945.1.21709 FBpp0073131 FBpp0073132 FBpp0073133 FBpp0073131 FBpp0073132 FBpp0073133 FBpp0305196 FBpp0195494 FBpp0265661 7227.FBpp0073133 7245.FBpp0265661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]