SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0073611 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073611
Domain Number 1 Region: 150-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 2 Region: 264-385
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-17
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 3 Region: 391-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073611   Gene: FBgn0052635   Transcript: FBtr0073780
Sequence length 677
Comment pep:known chromosome:BDGP5:X:13339939:13413663:1 gene:FBgn0052635 transcript:FBtr0073780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRGSTCSAQQPQQRPHKQQQQQQQQNQRLIPGQRCSLLMLLIVGQAVYASAGSEIIAN
RSASAGESLIMLSNFTVATPPPAPRFTSPFREQDVAEGEELAGGGQVDWLDEQHPLTISR
PPRAGRSERQAEEDQVDRCRLFVEGDPTKNELYSPEYPNLYPKNINCTRVITAPKGQIIR
LDFRNSFNIEAKEGCKFDFLEIRDGQYGFSTLIGKFCGTDFPPEITSKERYLWLHFHSDE
TIEYTGFSAVYEYLDRSRDAPSTDLNCTIDKGGFEGFINSTDVPAEIWEQVNRNKIALDC
IWRIQVKENWKIFLKFLDFKLSKPNDCQTNFLDIFPEQTVMPLRVKNFCGSAGESITAES
NILHLRFYADQTAINSTFGILFTAFRERGAACTEDEYDCEDATCISKDLKCNNLDNCKFR
WDEEGCTSEAAGQSEHVVIIVIVFGLILGGMVITFIVNCIRKIIRDQKIIRDVPALSDGI
YHIDSFILEAPKSAIFVGLQNDFMCDFSYSSDGQMAPNLGHETRDEEAAVGGDSDFDSQM
DSPKQTCDCDFELDVNDGEQMEEDDEEELEEEQEQDHHVEDQEYDDGIGFSCDSDSGLTL
PEDDDEFVLVTGQCLPSNSSHSCSSSMQCSSGSSGREVATSSSNSMELDMVLTPPPPPTL
GKPKSGVHPLKFLHKII
Download sequence
Identical sequences Q9VYC7
NP_727708.1.81976 FBpp0073611 FBpp0073611 7227.FBpp0073611 FBpp0073611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]