SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0074918 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074918
Domain Number 1 Region: 496-630
Classification Level Classification E-value
Superfamily TPR-like 2.96e-19
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0074918
Domain Number - Region: 431-523
Classification Level Classification E-value
Superfamily TPR-like 0.0721
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074918   Gene: FBgn0036772   Transcript: FBtr0075152
Sequence length 798
Comment pep:known chromosome:BDGP5:3L:17902583:17905657:-1 gene:FBgn0036772 transcript:FBtr0075152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVADIFSEYYICNFNDAVTVEDLPADETLRQLWTRQKLWTIDELREILQRWQEHVKPDPN
DNPTSQLKDFLLLIFAFVQNSFTGPFDKLEEYQQIHSELELEKLDALEKLKASGEELNPN
VKSVELLLIAREILEGLLENHPESKVLIWWRLRLICLHQHVLDDLAASLYEQFKSAAGHL
QAHFNQFESRELQSLLLLELANGYLQFHRSEIASQILDELCKHLQVELKVEGLLGVRTKF
QQKALPQLCLKVEHLNEQQPLPPAVQTNETTKLPKLLLLEDDTRLERIRFVELKDNEVMT
LPSVLQALVLAKVKQLKRSTPKDRLADEQLEPYTQTLLYQEHGPFQVRQSALLLNCLQES
NQRRTVERSWKQCEECVKLLDTSEEELSLRSRLSYGFAAHLSPKWQVQLQLVDLLRSLGM
TKTALDICLRIHAWQQVIECYTSLELRHKAAEIIRQELEKKPTALLYCLLGDAIDDPSFY
EQAWLYSKKTSGKAQAYWGNHFYRSADYAQAMDHFEISLEINNLQEAILLRCGYCAIQLE
RWEPAVKYYLAYTHLEPNGFESWNNLAKALIKLGDKQRAHRVLGEALKCNYSNWKVWENY
MLVSVDTSHWDDAMRAYQRMAELKQHYLDQEVLTRIVYGVSKEDPAGSSALIKRLIKLLG
QQSIQHGNEPLVWELAALVAQTPLKKAEKLVKSYRAYTPKHLGWETKSEHALKALDLCLE
VCDLSVAAITEHIQEESEVMITSQLNSARLAGTSCLNALKRAINVDVSAEQTAKVEQLEK
RIEDLTKIVQERMNASRS
Download sequence
Identical sequences Q9VVM8
NP_649026.1.81976 FBpp0074918 FBpp0074918 7227.FBpp0074918 FBpp0074918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]