SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0076891 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076891
Domain Number 1 Region: 44-411,578-657
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.84e-39
Family Pyridoxal-dependent decarboxylase 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076891   Gene: FBgn0031174   Transcript: FBtr0077190
Sequence length 852
Comment pep:known chromosome:BDGP5:X:21195072:21199176:1 gene:FBgn0031174 transcript:FBtr0077190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAGRSVDDPGQSPLVDQEPDPGQSTPAVAEIAASSIRSGLAELELRSSQVLQRLENVK
VSTTPESPNPVENEEEAGERVTSEDLLPAKHRVPSDILKSLEQLVSYTDSDDDPEFPLPA
LDDVSHLALISHSIVAYLSHLDRQQLLRVTNSISGDATRWLGTLFHFAHPASSFHADNAD
AVLRTVRLAIVARCPGYLEGGIPALAQPTFYISENTTPMRLHYACRQLGIPLEAIKVIPE
HSQSGTMDVTLLQKQIQQDVGNNRTPLLVVADIGASLCGYVDNLLRLRDVCKAHNMWLHA
SGHGLAALVCAQNQGHVEEVLHSMALNLGSWLGVPSLPIVLLHRPLQNSALSAFESDPIL
SRRLNALSLWTSLQALGRKAIAERLHVAFQTCSILFEIASKCEGIRVLSHTPGAQTGASL
SDVIQSPFDVQALFDAAAPVVAYQFDGSTTIPLGGSGSSAAAAAAERETAEGLKPLEKIN
NASYFDRLNSWLGQILQRDCPNFDFEVIEHPTHGSCIRYCPLELGLGEQPPSSENLESFA
QSLEAHVDILRATIKHKARFIHLVECSDVLRLVPLPEWAGMGGVRFVPEGWESLLTDQAK
TELNKLNIDLVEALKSTDNAFSLGEGTDGLICVRFGMVTHETEVEELLDLVVTVGKSVQE
NSRVLDTMSEIVKKGIEAVTADLQRESEEKLWQEGILRHVPVVGRVFNWWSPPAKESGIK
GRSLNLTQGVVESTENIYKYHMQMTGATAHQLPANRSPPTPMVQTPVVAPALPPVFPTVE
PVPGNGNGSGASEGTPVQSGEASGSMPAASGAAPSAAPTQNHVDHARTVSQSSAASSTVP
ELVAASSAINNN
Download sequence
Identical sequences Q9VRG8
7227.FBpp0076891 FBpp0076891 FBpp0076891 FBpp0076892 NP_608450.1.81976 NP_728413.1.81976 FBpp0076891 FBpp0076892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]