SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0077676 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077676
Domain Number 1 Region: 66-89
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000301
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number 2 Region: 260-283
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000349
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 3 Region: 184-212
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000108
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  FBpp0077676
Domain Number - Region: 146-174
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000406
Family CCCH zinc finger 0.0038
Further Details:      
 
Domain Number - Region: 121-144
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0017
Family CCCH zinc finger 0.0064
Further Details:      
 
Domain Number - Region: 40-65
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0576
Family CCCH zinc finger 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077676   Gene: FBgn0015621   Transcript: FBtr0078011
Sequence length 296
Comment pep:known chromosome:BDGP5:2L:819964:821209:1 gene:FBgn0015621 transcript:FBtr0078011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDILLANVSGLQFKAERDLIEQVGAIPLPFYGMDKSIAAVCNFITRNGQECDKGSACPFR
HIRGDRTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQ
SKVKDCPWYKRGFCRHGPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMHPHFELPPLAELG
KDQLHKKLPTCHYCGELGHKANSCKQYVGSLEHRNNINAMDHSGGHSGGYSGHSGHIEGA
DDMQSNHHSQPHGPGFVKVPTPLEEITCYKCGNKGHYANKCPKGHLAFLSNQHSHK
Download sequence
Identical sequences Q9VPT8
7227.FBpp0077676 FBpp0077676 NP_477156.1.81976 FBpp0077676 FBpp0077676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]