SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0080894 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080894
Domain Number 1 Region: 318-480
Classification Level Classification E-value
Superfamily TPR-like 4.17e-30
Family Tetratricopeptide repeat (TPR) 0.0064
Further Details:      
 
Domain Number 2 Region: 162-365
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000142
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  FBpp0080894
Domain Number - Region: 456-544
Classification Level Classification E-value
Superfamily TPR-like 0.000835
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080894   Gene: FBgn0032863   Transcript: FBtr0081362
Sequence length 678
Comment pep:known chromosome:BDGP5:2L:20459395:20461729:1 gene:FBgn0032863 transcript:FBtr0081362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMQKFFSVLLPDVKRELRRGIIECSKRGLLHSTKWLAEMHHGLADVHIDNEAPDEDRTF
SECQLEGIAPEEYSDYFLAKSYYDVREYDRAAHAVRNCESSVPRFLHFYSSYMAREKRRL
DSTTDQANLHEPNQMRDLADLLATLRMEYGKSRLDGYGIYLYGVVLKALNLNQAAEQMLV
QAIRLVPMLWSAYLELSPLIMEKKKLLSLQLGGHWMRHFFMAHTYLELYLNDDGLKIYED
LQASGFSKSIYLIAQMALVYHNKRDVDKAIELYQALLESDPYRLDNVDTYSNLLFVKEMK
TEMAQLAHKAVSINKYRPETCCVIGNYYSIRCDHQVAISYFQRALKLNPKYLAAWTLMGH
EFMELKNTNAAIQSYRKAVEVNKRDYRAWYGLGQAYEIIKMHYYSLYYFKIAHQLRPYDS
RMLVALGETYEKLDKCENAVKCYWKAIDVGDIEGIAMYKLANLHEKLGDHETAVHCYIMY
CEDERAATDKQSLYQGFITLANYYEKKGEYERAAYYAYKCLDSEDRKMEAKALLKTIDWK
RNAEGQKKVKTSTAVANADTSSEDEMEWELQDVRVRVPITSIATTTTSTTTVAAESASSS
SLISLRPDRNLIQGMRRSQSSRTSLTAPASGTTTTPSATAVTMSTEETPGTSGGPSNPPE
QAPSDDNSSMEISSVSID
Download sequence
Identical sequences Q9I7L8
FBpp0080894 NP_001260629.1.81976 NP_610036.2.81976 FBpp0080894 7227.FBpp0080894 FBpp0080894 FBpp0305185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]