SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0084171 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084171
Domain Number 1 Region: 169-377,439-689
Classification Level Classification E-value
Superfamily TPR-like 2.66e-69
Family Tetratricopeptide repeat (TPR) 0.00055
Further Details:      
 
Domain Number 2 Region: 771-836,874-939
Classification Level Classification E-value
Superfamily PIN domain-like 0.000000000569
Family PIN domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084171   Gene: FBgn0039260   Transcript: FBtr0084796
Sequence length 948
Comment pep:known chromosome:BDGP5:3R:20855145:20859177:-1 gene:FBgn0039260 transcript:FBtr0084796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKGTREQNDISLIIGTLPKRLQNKIAASCSHAAAAATTTKALETENAENAEPVATTAN
ASRPVEILSNASTGGGKPDAQSKQPVLDTSGKMAWEGGIPGILRVTTSVAGDVNRNGQGQ
GKNKSGNSARRRGRKDKEHATQSPVTRTRLTTEHPDWFEPLLGLPHAKNIVHLYDQLMVL
NQRNLILINWKNFCYIHDQLQDAFKQLLLEQLKFVCEHKVDVFFWKLLFYNVRNYLKRQQ
TDQAHTHTLLLIEQAIKFYRMLYDKLMAKCVASSRCDSALKVVAQRLLICLGDLTRYRVN
HVKATDYMEAARYYQRAQELVPGNGAPFNQLAVISIYHHKRFDAVYYYVRSLLTSNSIQS
AKESLLDLFDEIRRKYEETEMKQSPMHYAAGSKNQKSKQMRKEVWIYPDGIRRLHRTDDK
GNKAKGNKATMAEVNRYEEMPPEEILPRIVSLYLYLLGKLYTGTDVDSLYPLLRKLQIQI
GVALRHENLLSRSKLLKIVALNLFVVEHNKPKTSRREMRYHSFNFANSFFGLMMKKTNQL
LAGFVEDSTNVQCLPEEDFATVNTYLQFVNVYVRWLSISLDVWEPVRSEEHSFIDCWAEL
TILFEYIECLMGKHKLEKNEILLDEDVALRGFTPLGRETLSMDYLKRGSERLQFFERVRR
IGQFQEYYVQHQEALQQPLESSFTVEHLNAAMKNALENYDAESCGLAANVSKIQCKAVEE
LLCRSTDSDVSELCKLKKELEAKARVKQICTSKLEDILKFVDTKIYIEVRPRYLLPDTNC
FIDCLEDFEKLSTEFKRYTLIIPLTVVKELDGLSKGVKLDSYRSSKQTQRIHHFDEVSSR
AKKSLEFIKSAKGNVKCATTKGSFVNASVFALVEEEYLSNDDKILATAMAVSKTAKTEQC
TDGKCFIQTELVLITTDRNLRVKALSRNLAVSALDEFLQWAKDCREST
Download sequence
Identical sequences Q9VBZ6
NP_651321.1.81976 FBpp0084171 FBpp0084171 7227.FBpp0084171 FBpp0084171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]