SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0084440 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084440
Domain Number 1 Region: 227-349
Classification Level Classification E-value
Superfamily TPR-like 2.6e-27
Family Tetratricopeptide repeat (TPR) 0.00086
Further Details:      
 
Weak hits

Sequence:  FBpp0084440
Domain Number - Region: 13-92
Classification Level Classification E-value
Superfamily V-type ATP synthase subunit C 0.0615
Family V-type ATP synthase subunit C 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084440   Gene: FBgn0039463   Transcript: FBtr0085068
Sequence length 469
Comment pep:known chromosome:BDGP5:3R:22773590:22775404:1 gene:FBgn0039463 transcript:FBtr0085068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKEKKKSLLERYNIPIHYLDFAHVEKCTNAREMEKIVQILRSGEEGHYPDLQRCAEEKL
KALKPDSKLFRYEEQIKQSTDLDKTELKPILDWTDAIKTKDNALNELKKVKQNLNLPSVR
KLSKIDLEKESKTEKPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEE
RDQEQREKIISNHSKSVTTDKLQSERDSLYERLQAQLKNLSQLEKEQFAERHRLRGNESF
KAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKA
HLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLGEVAPSSATRLIIEE
IDPPQLKTSEPKKEAEKSEPTVVKKPEPVVSAKKPPPIKDYDLAELVKPNRMVKSNLVSA
AEALGNKMQASKGGAPKKPQSPPMTPKETLLRLPQDNLNNSNKLLIQEI
Download sequence
Identical sequences Q9VBA1
FBpp0084440 FBpp0084440 FBpp0084440 NP_651514.1.81976 7227.FBpp0084440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]