SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0084691 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084691
Domain Number 1 Region: 680-965
Classification Level Classification E-value
Superfamily TPR-like 1.94e-43
Family HAT/Suf repeat 0.0077
Further Details:      
 
Domain Number 2 Region: 370-557
Classification Level Classification E-value
Superfamily TPR-like 9.1e-34
Family HAT/Suf repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084691   Gene: FBgn0039600   Transcript: FBtr0085322
Sequence length 1066
Comment pep:known chromosome:BDGP5:3R:24637826:24643076:1 gene:FBgn0039600 transcript:FBtr0085322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEGENVVMESPGRRTRSGRKAASPAASLPTRSTRRTSKRNVQLSDHEEEAEEQVVMVQ
EEEEPFRGTNTAEAPALEPQFEETQHQIEDDVEMLPAEAAGVDEKSSSFPFGTVAELHSE
TSDDIKETRGQAGVDTLLASLAGDNANSLPSVGGNDESDNVKKADFEYNVDSLQPQMEKM
NSSEDSSSQHAIAEDLADADTSNATIVNTEIVSEDELPLPSKPEINDAEEVSDEELPAPQ
RAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENESVKSTEDKDASSHESSTKDKS
SEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERDKDKEKDKDKDNNKDKEKERK
KLPDLDKYWRAVKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCYGYWRKYA
DYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYERAVKACG
LEFRSDKLWDAYIRWENESKRYHRVVQIYDRLLAIPTQGYNGHFDNFQDLINQHDVTITL
ANEEVIRLRKDFHERQQSKSSKSSSKHRRDSSSSSKDKDSKEREREKDKDKDKDKDKEKR
ETVGGGVGKSPKDTSETQVDESDSTTDLTTESESSHAASKPAMQIDFSDLSTLNDEEVVS
IRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHVKPLERAQLKNWKDYLDFEIEKGD
RERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYRRACRIHHPDKPSL
HLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRINVERRRGALDKCRELYKHYIE
STKNKGIAGSLAIKYARFLNKICHDLDAGLAALQQALERDPANTRVALQMIDLCLQRPKV
DEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDFGSTARGLQDAQRALQQALTKAKE
AQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAVAGYNYGAANPYYGQQNTAAA
YPSQTPQQASYDSYYNQWGYGSGGASANSGGSGYNYGQWSGYGNYY
Download sequence
Identical sequences Q7KRW8
7227.FBpp0084691 FBpp0084691 FBpp0084691 FBpp0084691 NP_733256.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]