SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0086158 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086158
Domain Number 1 Region: 97-503
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.36e-118
Family Pyridoxal-dependent decarboxylase 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086158   Gene: FBgn0010591   Transcript: FBtr0087007
Sequence length 545
Comment pep:known chromosome:BDGP5:2R:12975939:12979462:-1 gene:FBgn0010591 transcript:FBtr0087007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPFSGSDCLKPVTEGINRAFGAKEPWQVATITATTVLGGVWLWTVICQDENLYIRGKRQ
FFKFAKKIPAVRRQVETELAKAKNDFETEIKKSNAHLTYSETLPEKGLSKEEILRLVDEH
LKTGHYNWRDGRVSGAVYGYKPDLVELVTEVYGKASYTNPLHADLFPGVCKMEAEVVRMA
CNLFHGNSASCGTMTTGGTESIVMAMKAYRDFAREYKGITRPNIVVPKTVHAAFDKGGQY
FNIHVRSVDVDPETYEVDIKKFKRAINRNTILLVGSAPNFPYGTIDDIEAIAALGVKYDI
PVHVDACLGSFVVALVRNAGYKLRPFDFEVKGVTSISADTHKYGFAPKGSSVILYSDKKY
KDHQFTVTTDWPGGVYGSPTVNGSRAGGIIAACWATMMSFGYDGYLEATKRIVDTARYIE
RGVRDIDGIFIFGKPATSVIALGSNVFDIFRLSDSLCKLGWNLNALQFPSGIHLCVTDMH
TQPGVADKFIADVRSCTAEIMKDPGQPVVGKMALYGMAQSIPDRSVIGEVTRLFLHSMYY
TPSQK
Download sequence
Identical sequences Q9V7Y2
FBpp0086158 FBpp0086159 FBpp0086158 NP_652032.1.81976 NP_725652.1.81976 7227.FBpp0086159 FBpp0086158 FBpp0086159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]