SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0086164 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086164
Domain Number 1 Region: 397-526
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000968
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 2 Region: 139-273,385-424
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000269
Family Tetratricopeptide repeat (TPR) 0.0051
Further Details:      
 
Weak hits

Sequence:  FBpp0086164
Domain Number - Region: 647-822
Classification Level Classification E-value
Superfamily TPR-like 0.0221
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086164   Gene: FBgn0034186   Transcript: FBtr0087013
Sequence length 868
Comment pep:known chromosome:BDGP5:2R:12947376:12950139:-1 gene:FBgn0034186 transcript:FBtr0087013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSDSNEVLIEEIDSNDVPENELEQFQETEPLRVVDIIDCDTDGERRCIADDEEEGALI
KRYVQGVQCLEFPDFCTKLEASDEDEEGNDEEPSEAAGSIEKPNTSAQAKTSQEQSTGSG
RSGGGGFRKSQLSTALQGLMGEANLSFVYGRYETAERICMEIIRQNPLASEPFYTLAEIY
ENRDEVKFLNFSTLAAHLNPQDRDMWIRVSDLLVQQGNLARARLIYTKAIKMLPKVYQLR
LRKAQLLQKMGETNASMFTYLKMLPLMPPDEWKMCLNTAKNVARYFHVLEKHSLALEAME
GAYSVCGARFTLEDINIYLELLILNKQYAKVLRCLRERTNFELENDQEESLELIYFCEIP
DDYVPELRAKLCVSLIHMRAHHLLGYLIQNVQEHITLTADRVELYMDITEALMQEHKYAE
AIALMSPITDGDTVECPAFVWLRQAECLRQLNRTNEAIQSYEKVVQLAPFCYDARFTLSA
LLKQQGRHEEAVQALEQPGEAEGQPLIARLLYERCVMLQQIGRIEEFLDVGYALLSRHSI
KLYNREEMMAAANGGSAYNSESLKTIIQMRSKAVDNSAEQDLQDPAKNAASETSDLTVKD
EFELFRELVRTAFKHGMHSAAEKICFAMVTTKRFTYYHHEIERIMVLTCYYNDDCAIAFS
YLRELIAKQPSQTTLWNMLSLMIQKGDEVRYYRYMRRLMQRHPVDTKPMRIFQGHYHLNC
ASFKYALNIYMPILRENPDPLVALCIAVAFNQLSLQKKVLRKSASVAQAVAFGQRYKELR
SAGHELADCAAQQEIFYNIGRIYHQANILHLAVDYYEKALAVPVHPLIAEHESTLGLQHE
VAFNLHLIYRANGNKWKARQYLMRYCVV
Download sequence
Identical sequences Q7JVW5
FBpp0086164 FBpp0086164 FBpp0297722 7227.FBpp0086164 NP_001246384.1.81976 NP_611184.1.81976 FR736 FBpp0086164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]