SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0086380 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086380
Domain Number 1 Region: 260-402
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 1.57e-37
Family Hypothetical protein c14orf129, hspc210 0.005
Further Details:      
 
Domain Number 2 Region: 1183-1298
Classification Level Classification E-value
Superfamily TPR-like 0.00000000675
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 3 Region: 1101-1213
Classification Level Classification E-value
Superfamily TPR-like 0.000000624
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086380   Gene: FBgn0034087   Transcript: FBtr0087242
Sequence length 1448
Comment pep:known chromosome:BDGP5:2R:12074090:12081754:1 gene:FBgn0034087 transcript:FBtr0087242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALETEAKNSNATATGDATATATKASGKAKENNNTAGGKKNLNPNSNQQNSNQNLVNGNG
TAADGPAAKKKGKKNRNKSPTEPTTEAVLSNGHAEKPTVVDAVEDNADTNANVEKPQEGG
APDAEADGDDIDLDALQDIGITVNISSPGADLLCVQLSSMELVQEIHQLLMDREETCHRT
CFSLQLDNVTLDNFAELKSINNLEQGSTIKVVEEPYTMREARIHVRHVRDLLKNLDPADA
YNGIDCTSLTYLNTITQGDLLDKKRTRPDSVDCTPPEYVTPGVSDPPILPLHPNVKNAKG
PQALKVLTTSAWNPPPGPRKLHGDLMYLYVVTMEDKRFHISACSKGFFINQSTDDTFNPK
PDNPSHLSHSLIDLLSHISPSFRRAFQTIQKRRTMRHAFERVATPYQVYQWAAPILEHTV
DAIRAEDAFSSKLGYEEHIPGQTRDWNEELQTTRELPRKTLPERLLRERAIFKVHGDFVT
AATRGAMAVIDGNVLAINPGEDTKMQMFIWNNIFFSMGFDVRDHYKELGGDAAAFVAPRY
DLHGVRVYNAVDIEGLYTLGTVVVDYRGYRVTAQSIIPGILEREQEQSVVYGSIDFGKTV
LSHPKYLELLRQAGKHLKILPHVVLNERDEPVELCSSVECKGIIGNDGRHYILDLLRTFP
PDVNFLKLQDVQLSKELVDMGFPIEHRHKLCCLRQELLEAFIEDRHVNFIRIAAARLQQL
TTIKQSEKSEANPVPALEGAEAASKVNGAEKPDDKEKKNEEEEKKERSTSGEARAAAIVN
AIREAQSNVATSNEVQAAEVVKRACAAVGSLKEKEFDFRFNPDVFSPGIRHADGEEGTSL
AKQKVLVQEAAEFLVLKQIPAFIKEHMSHSSSPIDGQSLTESLHSHGINVRYLGKVIKIL
SQMPRMDYLHRIAVLELIVRATKHIYYTYMQNTEPLHLSAAISHFLNCLLTNGPVNPAVS
SEEAHKKRGNGGKHNKHKSSKGGKGQQQQQTTGNQNGSSSGSSNSSSASDWTLMTPRSLW
QQIRKEAKVYWDWELDCDSIETAVSKYGILRISLMRAFCLKVGIQVLLREYNFESKHKPT
FGDDDIVNVFPIVKHISPRATDAYNFYTTGQAKIQQGLFKEGYELISGALNLLNNVFGAL
HQENGSCLRMLARLSYLLGDAQDALAIQQRAVIMSERVNGMDHPSTILEYTHLSLYSFAN
GHVGMSLKLLYRARYLMVLICGEDHPEVALIDSNISLILHALGEYELSLRFIEHALKLNL
KYFGDKDMHVALSYHLMARTQSCMGDFRSALNNEKETYSFYKSQLGENHEKTRDSAECLR
LLTQQAVLLQRKMNDIYSSGKLTSDLPPIHITPPSMGSVLDMLNTINGILFVKISRKDIV
KVRSEIEKHFKTDSTENEVNDAINSIVAAANNNGEAEDAVSKDIKEQPEAGKQLTNGDKA
AATEATSS
Download sequence
Identical sequences A1ZAB5
FBpp0086380 FBpp0086380 7227.FBpp0086380 NP_611095.1.81976 FBpp0086380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]