SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0112016 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112016
Domain Number 1 Region: 220-330
Classification Level Classification E-value
Superfamily TPR-like 1.87e-20
Family Tetratricopeptide repeat (TPR) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112016   Gene: FBgn0034692   Transcript: FBtr0113103
Sequence length 465
Comment pep:known chromosome:BDGP5:2R:17973397:17976084:-1 gene:FBgn0034692 transcript:FBtr0113103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKKPKVDTLEEIETNIKLLCDQSNNHMKVRAYEKALFGYNQILPSDCQGYYKDMSNVL
NTILAVDKEQELLQSFIRTGAAAEEESQDETNRRSKGRSHKPPIWERRESTDRGGRGAGR
DGKQGDDGGAGGGAGGDAAGGKRGNRIEAELRAARKKIEEQIAKKKKPKENFVDFYTDKD
RAAAVSAGAFDIKQSLQIKQKQDRNEALLIPDEADISSVIALGLKEIKNANPENAIHFFC
KALELNSTDINALISRSKCYLLLGEASKALQDAETALGEDKNNIRAIYQKAESLYYLGQF
EQSLMFFHRGLRARPELALFRLGVQKTQEAIENTIGSKPGPPGPTASVPKSGKSRKSGED
TPKSQAAGATGTSARTRQKPSRADLERRNARKLLGELCVDKEYLEKLLLHPDLVRADTHT
ESISAYAREAVEFLNKRQEFWRQQRPCTALPNHKNLPHDALPKWF
Download sequence
Identical sequences FBpp0112016 FBpp0112016 7227.FBpp0112016 FBpp0112016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]