SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0112455 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112455
Domain Number 1 Region: 22-313,341-583
Classification Level Classification E-value
Superfamily TPR-like 9.48e-144
Family HAT/Suf repeat 0.00000000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112455   Gene: FBgn0003559   Transcript: FBtr0113732
Sequence length 765
Comment pep:known chromosome:BDGP5:XHet:69195:80010:1 gene:FBgn0003559 transcript:FBtr0113732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARDLIKVDIEWGMERLVRAQQVVELRPYDIESWSVMIREAQTRPIHEVRSLYESLVN
VFPTTARYWKLYIEMEMRSRYYERVEKLFQRCLVKILNIDLWKLYLTYVKETKSGLSTHK
EKMAQAYDFALEKIGMDLHSFSIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTP
IVGIEQLWKDYIAFEQNINPIISEKMSLERSKDYMNARRVAKELEYHTKGLNRNLPAVPP
TLTKEEVKQVELWKRFITYEKSNPLRTEDTALVTRRVMFATEQCLLVLTHHPAVWHQASQ
FLDTSARVLTEKGVRTSVENISPILCVPVVNQIEWVMAFAWWWAKDVQAAKIFADECANI
LERSINGVLNRNALLYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQYMKFARR
AEGIKSARSIFKKAREDVRSRYHIFVAAALMEYYCSKDKEIAFRIFELGLKRFGGSPEYV
MCYIDYLSHLNEDNNTRVLFERVLSSGGLSPHKSVEVWNRFLEFESNIGDLSSIVKVERR
RSAVFENLKEYEGKETAQLVDRYKFLDLYPCTSTELKSIGYAENVGIILNKVGGGAQSQN
TGEVETDSEATPPLPRPDFSQMIPFKPRPCAHPGAHPLAGGVFPQPPALAALCATLPPPN
SFRGPFVSVELLFDIFMRLNLPDSAPQPNGDNELSPKIFDLAKSVHWIVDTSTYTGVQHS
VTAVPPRRRRLLPGGDDSDDELQTAVPPSHDIYRLRQLKRFAKSN
Download sequence
Identical sequences P25991
FBpp0112455 FBpp0297502 FBpp0112455 FBpp0112455 7227.FBpp0112455 NP_001015241.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]