SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0112925 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112925
Domain Number 1 Region: 243-387
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-40
Family Third domain of FERM 0.0006
Further Details:      
 
Domain Number 2 Region: 141-245
Classification Level Classification E-value
Superfamily Second domain of FERM 8.64e-34
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 59-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-23
Family First domain of FERM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112925   Gene: FBgn0004049   Transcript: FBtr0114376
Sequence length 972
Comment pep:known chromosome:BDGP5:3R:9254589:9260704:-1 gene:FBgn0004049 transcript:FBtr0114376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRFLSRRKVRNNYVDNSREGGGATSSAVGVAGGGGAITSGGSSQIKPQRIVVNKNKIDC
RVILLDNTDLSIELSKKALGSFLYEQVFYALDIIEKDYFGLQFMDANHVKHWLDPTKPIK
KQVKIGPPYTFRLKVKFYSSEPNTLREELTRYLFFLQLKQDLLEGRLDCPEDKATELCAL
ALQSELGDYDNQEHSAATVSEFRFVPEQTEDLEIAILDEYKTCRGLTPAQAETAFLNKAK
WLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIV
IEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLRAPVKGPSARQNFFRMGSRF
RYSGRTEFQTTQQSRARRTVQFERRPSQRFASRQSHLLRERQKASQEAAVSAVASVNARA
AAAAAAAAASQSPAPATPLVSSQVSTPTPNNDNNNDAFDSLISTDQFITVTPSPSVLTVI
QNSAIIEPDAACSGSISSSSQAAANFASLGRNSLKSNFSNEDPAYSKIGSIGKASGLTVK
LDPDYTPPYSPNATKNFDETNPFRNATSSHHGSFGKASISSGQLSVKSGLSDKDRELDSL
LKSIVKDPSPSVLANEAINDANSIRVTINKTFDMDHNTETLKRLSNANEKPNNQVKLANV
NTTALPPGNIKCNILKARVEEELGAGGNAKLTNQMFVPAAHSSNMHTSNTNSSNNHAHSD
GPDSLNATYISVGGDKLTLSIPEQKPSTGSSSSSSTSSTATTTTNGNGPYSNATFVSGFS
APLTPPSSLPANLNNTGSGCNTTLTSVTTISTPSSPTATVSTTASESVAPALSNASAAEI
LINEIFINNIINNNASGSITAETAAKPAGSSTPSAGTLLFSTLSEQERLESQKTNQQMNQ
SLNLNQNHSEVDAPPSEKKTPSNYPDSSRIPFPSSSNSKDMVSPWLVSSEVVSAPKGRES
AIIRKSVITTQL
Download sequence
Identical sequences Q9VFU8
FBpp0112925 7227.FBpp0082261 FBpp0082261 NP_650291.1.81976 FBpp0082261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]