SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0293629 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293629
Domain Number 1 Region: 646-789
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00000000000000162
Family Type II Proline 3-hydroxylase (proline oxidase) 0.064
Further Details:      
 
Domain Number 2 Region: 475-599
Classification Level Classification E-value
Superfamily TPR-like 0.000000000228
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293629   Gene: FBgn0034075   Transcript: FBtr0305092
Sequence length 803
Comment pep:known chromosome:BDGP5:2R:11997990:12004501:1 gene:FBgn0034075 transcript:FBtr0305092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDVQPRKRKDKRRKRDDRKSEGDVTVLRQSSFQDDDESSHGVHITKMGNEDLHLHVHH
DHGTGGHWCAKIIFFALMAVLLGLVGLIIMENRGLEDLDTPLSESRFSKVFDGWVDEHRD
EHDGHDVQEPSGEALDDHDEHDDHDDHEDEDEEPLTEELEEELEEEEEPTEEDEPAADEE
YEEDEDEENNAGENITAEDAEEEEEEEDNDDEGTVEATVEATTEATTEATGEYEAEEDDE
DEAAADDDAVESTEAPLSKAEEQEDDEDEDEEEQEIEESVEPERSQYAAQSAPAKDNNDD
DDDDDQDKNDADDGDDDEFESLAQQFENDPEDTVPAKAVESEEQDQDQADEEEPKEEGSS
WLASQIKPKEAAPAPAEKEDPFEQELRKANEEMIRENYAQALRSFNTLTTNFAHEPSAHL
GRARLLELLAKKERSNQRLWEAIDAYKRYLAFGELVASNQEFQTAGESCIENLRFLGHHR
QATTIHELLINRLPEDPRLRNQLSLTYLMVNNLQQVEKVAVETLKLWPNNAVAQLHYGLA
LRQFHADYAKALPYLKYAVESGEEGTQEAFFYLSLGETMQRLSMKSEALEVYGKGVAKGF
FASLYQRSLYNEPRLRAQPFWQPKETGYERQLEKLTLNWRAIRDEGLALLGRSGFFEDEA
ELLRDKGVWQQYELYAQGRRVKDNCRRAPITCSLLEEFPESAGCRRGQVKFSVMQAKTHV
WPHCGPTNCRLRAHLTLAAPEPEKASLRVAEQERTWREGELFIFDDSFEHEVWHNGSQSR
LVLILDMWHPQLSAAQRRSLSPI
Download sequence
Identical sequences A0A0B4K7C1
NP_001246357.1.81976 FBpp0293627 FBpp0293629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]