SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000004657 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000004657
Domain Number 1 Region: 390-556,864-1083,1138-1177
Classification Level Classification E-value
Superfamily Ras GEF 1.01e-106
Family Ras GEF 0.00013
Further Details:      
 
Domain Number 2 Region: 537-621
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-20
Family PDZ domain 0.0047
Further Details:      
 
Domain Number 3 Region: 268-393
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000089
Family cAMP-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 17-122
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000262
Family cAMP-binding domain 0.0025
Further Details:      
 
Domain Number 5 Region: 774-853
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000594
Family Ras-binding domain, RBD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000004657   Gene: ENSDARG00000005482   Transcript: ENSDART00000003826
Sequence length 1601
Comment pep:known chromosome:Zv9:14:50716244:50966935:-1 gene:ENSDARG00000005482 transcript:ENSDART00000003826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYVDNSFRQAVMVNPSDRTQQDLEIVYSYLHGMEALSNLREHQLRIMCETVRYERHEA
NEVLYYPDDIGTCWYILLSGSVFIKESMFLPRSSFGKRSAGSLRRGCECIVLEPSEMIVV
DYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPAGKPPVARGYHTLPADF
SRLHLADGIHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEPGDMDLSGLPETAVDS
EEDDDEEDIERASDPLMSRDIVRDCLEKDPMDRTDDDIEQLLEFMHQLPAFANMTMSVRR
ELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTHPDSRNEILCMGNSFGVSPTM
EKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEKNMQKVEEEGEIVMVKEHRELDRTGT
RKGHIVIKGTSERLTMHLVEEHSVVDPTYIEDFLLTYRTFLPSPMVVGKRLLEWFHDPSL
RDKVTRVVLLWVNNHFNDFEGDPAMTHFLEEFEYNLEREKMCGHLRLLNIACAAKAKLRV
VTLTKPSREAPLAFTLLGGSEKGFRIFIDSVEPGSKAAEAGLKRGDQILEVNGQNFENVP
LSKANEILKNNTHLSITVKTNLLVFKELLARPDQDQEQEQEEEPDRKNGAPHIPKIGDIK
KASRYSIPDLAVDVEQVMDLEKASKKAKANSAGGRNKLKKIFDKTLTSILPPKPYNDVGV
GQSQDDSIVGLKQSKQIPPALPVSGNLSSSNPDLLQSHHRILDFNNQPDMSDQVLRVFKA
DQQSRYIMIGKDTTAKEVVAQAIREFALTAAAEAYSLCEVSVTPEGVIKQRRLPEQLSKL
ADRIQLSGRYYLKSNMETETLCSDEDAQELLRESHISLLQLSTVEVATQLSMRAFELFCA
IEPTEYIDDLFKLKTRLTGPPSLKLFEEAINRETFWVATEVVREANQLKRMKIVKHFIKI
ALHCRECKNFNSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFSDLQDLFDPSRNMAKYR
NLLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRMAAVN
MDPALMFRTRKKKWRSLGSLSQGSANAAVLDVTQTGGHKKRVRRSSFLNAKKLYEDAQMA
RKVKQYLSNLTLETNEESLQTLSMQCEPSINTLPKSSGDRKRPDTSPVVSRAATHQRQQL
QKANQALQVPAVALYPSRKKVPVKDLPPFGTSSPQSLKKILSLSEEAGDRHRKQAEDSVS
NNSSQLSSPPTSPHSSPKKGYGRAGDYLSDSGHSEISSRSSLVSTSSLDMGQDERRQRYG
GTAGEGHGSGHRLERRATADPDQYSLGSYSSMQDCRGLYAGATVLSSPSSEELTQDQGDR
VSLDAADSGRGSWTSCSSGSHDNIQTMQQGRSWEALAEGAGLWGSRGSWASACSSSSSVA
CWGEDSEGDTGTIKRRGGRDVTTDPETSSITSTGSEESRQHSRRPSPITAGNTKASITRK
DGRYRDPPPTPPGYTALTITDVTEGTPHSGRKPPDYTTALQRSRLVTHSLDSQQPPAAGK
PDPRGREEDEAVEVEEEGECLSPKLRAQRRRGPHTAVPPRP
Download sequence
Identical sequences ENSDARP00000004657 XP_017214669.1.45394 ENSDARP00000004657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]