SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000012454 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000012454
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily Histone-fold 7.3e-43
Family Nucleosome core histones 0.000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000012454   Gene: ENSDARG00000001915   Transcript: ENSDART00000015372
Sequence length 140
Comment pep:known chromosome:Zv9:1:774782:775204:-1 gene:ENSDARG00000001915 transcript:ENSDART00000015372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKKLAAPQKSKTSVSRSARAGLQFPVGRIARLLRKGNFAARIGSGAAVYLTAVIEY
LCAEVLELAGNASRDNKKLRIAPRHIQLAVRNDEELNTLLGGVTISEGGVLPNIQAVLLP
KKTKAAREPNAGTEAQSQDF
Download sequence
Identical sequences Q7ZTT0
ENSDARP00000012454 ENSDARP00000012454 7955.ENSDARP00000012454 XP_002660369.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]