SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000016362 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000016362
Domain Number 1 Region: 28-122
Classification Level Classification E-value
Superfamily Histone-fold 1.5e-22
Family TBP-associated factors, TAFs 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000016362   Gene: ENSDARG00000013016   Transcript: ENSDART00000019440
Sequence length 179
Comment pep:known chromosome:Zv9:11:6232662:6241187:-1 gene:ENSDARG00000013016 transcript:ENSDART00000019440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATASAAPAESELDRSGAEEEPRGTEPEEDAGSGQTGPTAGAQQHRLARLPLSRIKTLM
KADPDVTLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDEFA
FLEGKRFNVISCWQSSKGAGESFMVHSDFLYFVTPFKASFSRNVELKNKRNSATVSGYV
Download sequence
Identical sequences F1RCI6
ENSDARP00000016362 XP_017213760.1.45394 ENSDARP00000016362 7955.ENSDARP00000016362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]