SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000017082 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000017082
Domain Number 1 Region: 92-416,448-559
Classification Level Classification E-value
Superfamily Ras GEF 2.09e-116
Family Ras GEF 0.0000701
Further Details:      
 
Domain Number 2 Region: 675-769
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.62e-39
Family Ras-binding domain, RBD 0.0000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000017082   Gene: ENSDARG00000005989   Transcript: ENSDART00000010604
Sequence length 804
Comment pep:known chromosome:Zv9:8:19808089:19867056:-1 gene:ENSDARG00000005989 transcript:ENSDART00000010604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISHYPLASLLPWPPVPQLLDIDGDGGVALQRYQPRSPETGPRYWSSVQDWGEEVEEGAI
YNVTLKRVQIQQAANKGARWLGAEGDRLPPGHTVSQLETCKIRSIRAGTLERLVETLLTA
FGDNDLTYTSIFLSTYRAFASTQSVLELLLDRYGSFEDCEGERSQCQTGESRKAVRKALA
SILRAWLDQCPEDFQEPPSYPSLHRVLGFLQKAMPGSEPMRRAQSLLEQLRVQASLENET
EGGFQYINPFCLGEDEEVEIDLQEDFFSFEVDLVAEQLTYMDALLFKKVVPHHCLGSIWS
QRDKKDGKQSAPTIRATITQFNAVTACVVSTILRQRQIRPHLRARIIQRWIDIAQECRIR
KNFSSLRAIVSALQSNPLYRLKRTWASVAKDSMQMFEELSDIFSDQNNYLTSRELLMREG
TSKFASLDSCAKDHQKRSQKRLQLQKDMGAMQGTIPYLGTFLTDLTMLDTALPDQVEGGL
INFEKRRREFEVIAQIKLLQSACNSYCLTPDPAFLRWFKSQPQYSEEESYVLSCEVEGLG
DNSPTSPKPRKSMVKRLSLLFLGNDSTNTSSPVRESPRSPPTGSSGESMDSVSVSSSDSS
PSESDGMTPTHSIDAHLKKLSESSSCNSLHSMDTSSSTASASISLASPTLPGPPCNHRRS
ISLTPLMSPTSPGFPPAYNTQAQDACIIRVSLEQGNGNLYKSIMLTSQDKTPAVISRAMT
KHNLEGEQAADYELVQVISEERELVIPDNANVFYAMSTSANFDFLLRLRGSEGRPVQLRS
RCSSTLPCTQQRSSLSLRLSKVTL
Download sequence
Identical sequences A9C3Q2
7955.ENSDARP00000017082 ENSDARP00000017082 ENSDARP00000120417 NP_991200.2.45394 ENSDARP00000017082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]