SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000032165 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000032165
Domain Number 1 Region: 44-104
Classification Level Classification E-value
Superfamily Histone-fold 0.00000531
Family TBP-associated factors, TAFs 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000032165   Gene: ENSDARG00000026806   Transcript: ENSDART00000039498
Sequence length 308
Comment pep:known chromosome:Zv9:23:32631040:32639573:1 gene:ENSDARG00000026806 transcript:ENSDART00000039498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSVMMGSGSLNSGSRSGSSKTCTSPTENYQLARRRTLQVVVSALLTECGFDSAEKAVV
ETLTEMMQSYITEVGRCAKANCEHTARSTPTLSDVVITLVEMGFNVDTLPVYAKRSQRMV
ITAPPITNAPVVPKSLTAGQKRTHPAHIPSHFPDFPDPHTYIRTPTFREPVSDYQVVREK
AASQRRDVERALTRFMAKTGETQSLFKDDISAFPLIAAKPSPIPYLSALLPSELELQSLE
ETDSSEQDDQMDNDNNTSHIMQDDSGADKENEVLPPGGVVPSGKANEENMIDNPYLRPVK
KPKVRRKK
Download sequence
Identical sequences Q6P0T2
XP_005162360.1.45394 ENSDARP00000032165 ENSDARP00000032165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]