SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000038222 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000038222
Domain Number 1 Region: 276-390
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-26
Family SH2 domain 0.00066
Further Details:      
 
Domain Number 2 Region: 599-797
Classification Level Classification E-value
Superfamily Ras GEF 5.75e-22
Family Ras GEF 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000038222   Gene: ENSDARG00000028099   Transcript: ENSDART00000029457
Sequence length 905
Comment pep:known chromosome:Zv9:10:10144145:10244373:1 gene:ENSDARG00000028099 transcript:ENSDART00000029457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKRKLSFKWFGSLTNLRRKSDAQKDDESVKEMSTDDMGMHPRSPSYATSSEMYTHMGTM
PRHSKKDKNSKKSKTKDKANLTRSQSLRPDHVVESPLLSMLSGKGLEVLENPIIEDKTAY
IQNRDLPPPPCVDGHSTRLEDENKKLEVNFKHVDASNACLGASIELCVSQESTVQPVLPK
KRLKEGDKLMKDTEELKEDNNLIQLPQKTGNQMEKKIAVEEDANIVWNYKLDGQEEKELN
SELDITENQGEYVEFSKEKYLLESPPEKLRKELEEELKLSSSDMRSHGWYHGHIPREASE
TLVLRSGDFLVRDSLSTVGDYVLTCRWQQEVIHCRISKVLVKSGQTKIQYMLENESFDSV
PTLVRHHAGTGRAVCPRTGAQLLCPVNRTLPLRYLEATFALAGGRPGSAYSPSAQRGAHI
KRRSVTMTDGLTTEKIIPHSPSTVHHKDAMRNCAMSMDQIQEYRCPLSPVGETPQSPAYS
AISRHRHGSGGRVLAVIPPSPVMRRSSDPHLSPSSSNNNIPCSETGPSTYSTPAHGYQSE
SLEQGGSYCELRPGQAPIPPCKSYVERLKVEEGQSLGSGAPDGVEGFMLPLVETSSSFKP
GKYQSTLLPPENKPLEMSVLKRVKELLAEVDPKTAAKHITKADCTVARILGVTKEMQRMM
GVSSGLEQLTLPHGHQLRLDLLERFYTMSIMMAVDLLGCTGSTEERAALLHKTIQLAAEL
KSNMGNMYGFAAVMRALELPQISRLEQTWMTLRQRHTEGAILYEKKLKPFLKAMNDGKET
CVLSSTCFPHVVPVLSLLERSVAAGEALESWESVESGVDVVMSHLEAARTIAHHGGLYRT
NAESKLQDFQERKEVLEIFCTEFQMRLLWGSRGSEGSQTERYEKFDKVLTALSHKLEPPV
RHSEL
Download sequence
Identical sequences ENSDARP00000038222 ENSDARP00000038222 XP_005155665.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]