SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000042900 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000042900
Domain Number 1 Region: 11-76
Classification Level Classification E-value
Superfamily Histone-fold 5.7e-16
Family TBP-associated factors, TAFs 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000042900
Domain Number - Region: 267-380
Classification Level Classification E-value
Superfamily ARM repeat 0.000222
Family GUN4-associated domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000042900   Gene: ENSDARG00000029135   Transcript: ENSDART00000042901
Sequence length 636
Comment pep:known chromosome:Zv9:5:63685830:63769955:-1 gene:ENSDARG00000029135 transcript:ENSDART00000042901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEERRQKLCSVILPTDSMKAMAESVGIGSLQEDSCLTLSEEVSYRIKEIAQDALKFMHH
GKRCKLTTGDIDHALKLKNVEPLYGFQSEEFIPFRFASGGGRELHFYEEKEVDLSDIINT
PLPRVPLDVSLKAHWLSIDGVQPAIPENPPSASKEQQKAESTEPLKAVKPGQEDEGFIQA
KGQSAVSAEVKGKEKMRMKPRSTHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDP
GLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYLHELIPAVVT
CIVSKQLCLRPDVDNHWALRDFAARLMAQSCKTFSTTTNNIQSRITKTFTKALLDEKTQW
TTRYGCIAGLAELGHDVIKTLIIPRLFVEGARIKAVMDGPVVSNIDKIGADHVQSLLLKH
CASVVAKTRPVPDLVEQYKADYGYLGTMLCSHVVKARAQAAFQAQTVNRTTLTITQPRPT
LTMSQSGLSTSGVSRTPSIIKVPSSLTLMSTRPGTPTQPSPPATKYIVMATSAGAASTQQ
VITLSSSQSGSPVTSTVPSTPTSLQPLVKLESGNPGAVGSSRPIQKYIVVSLPSSSSSMD
NKGSGVLSSSTSPISMESAVKLECSESPATSTQLPH
Download sequence
Identical sequences Q66HZ5
ENSDARP00000042900 NP_001004557.1.45394 XP_021331769.1.45394 ENSDARP00000042900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]