SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055151 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055151
Domain Number 1 Region: 108-196
Classification Level Classification E-value
Superfamily Histone-fold 1.39e-36
Family TBP-associated factors, TAFs 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055151   Gene: ENSDARG00000037855   Transcript: ENSDART00000055152
Sequence length 206
Comment pep:known chromosome:Zv9:23:325336:329694:1 gene:ENSDARG00000037855 transcript:ENSDART00000055152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPARVKPEAGTSVDRPKPGEGSSEGPEGSSKSSDPAAGQTAVKEEGKTLSQRPAEDAG
DEEEEGSSSLHPPPAKKLKVEPHDKKKEKRHKVDEDEIQKMQVLVSSFSEEQLNRYEMYR
RSAFPKAAIKRLIQSITGSSVSQNVVIAMSGIAKVFAGEIVEEALDVCEKWGDTPPLQPK
HMREAVRRLKSREQIPSSKHKHILFH
Download sequence
Identical sequences A8KBY5
7955.ENSDARP00000055151 ENSDARP00000055151 ENSDARP00000121547 ENSDARP00000055151 XP_005161952.1.45394 XP_021325453.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]