SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000057038 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000057038
Domain Number 1 Region: 388-481
Classification Level Classification E-value
Superfamily TAFH domain-like 7.85e-33
Family TAFH domain-like 0.0000172
Further Details:      
 
Domain Number 2 Region: 633-680
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000879
Family TBP-associated factors, TAFs 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000057038   Gene: ENSDARG00000075732   Transcript: ENSDART00000057039
Sequence length 833
Comment pep:novel chromosome:Zv9:20:18306330:18342154:1 gene:ENSDARG00000075732 transcript:ENSDART00000057039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSVSDKLENDNLRTQTEKKNEAQTNNIENLSETSDKKREVTDLNANVITNRNPDSVS
LNEKADPKTEAGSSNAAPQGPVTVSLLTSSTSASSEAAPKVMVGPAQIKSTTPVVVGARV
VTSSVQGPGTTSLALVPQPGRVSVAISQPRVTTLTTAKGPVMTLPRISTPSQGVPMTRAP
QTVPLQLPANFQVPQGMVLIRSDSGQLMLVSQQALAQAQGMLPKAASANASAIVRPPSSQ
ATVNTTPIIRVSLPPTSASATANIKLNPTVGTAVQKPAAATGTAVFTPSCSAGTTISKPA
AVVCTAVRKPSSTMGPVIKASQMTPNSSTPGTFNQRTNSVTATTVINTSAGKSVGKGGPS
IQSNAPRVVSPNVPPRSSTNTSSTPVTVTAETLENVKKCKNFLVTLMKLASSGTRSANMA
QNVRALVKGLLDGKLEAEEFTEKLYMELKSSPQPYLVPFLKRSLPAVRQLTPNSQLFIQQ
CDHLKPSDSALTKSTNQKASASVSSSLKNSQPTRTPQLVQTTGVVVKQPQVGLAAQSQTQ
SKQMVIQTSTHSTGAVVRQSILQASKTHFSQPTLPAQAHSFKDSTSGSFRDDDDINDVAS
MAGVNLSEENARILASGSELVGSVIRSCQEEPFLFPSALQTRVLHIGGSLGVTEVCPDVL
ELISLATQERLRDLLEKITAVAQHRQISYRDDWRYTQTNDTRSQLKFLEQLERLEKQKRE
EEERETLLRIARSRSNSEDPEQQRLKQRAKEMQQLELAQMEHRDANLAALAALGPRKKKP
LEAPGLGANQLLGSHGHFASRAPVRVTMRDLTFYMEQDPTFRHTLVLYRAFLG
Download sequence
Identical sequences F1QMF8
ENSDARP00000057038 XP_017208212.2.45394 ENSDARP00000057038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]