SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000062079 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000062079
Domain Number 1 Region: 25-94
Classification Level Classification E-value
Superfamily Histone-fold 4.76e-21
Family TBP-associated factors, TAFs 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000062079   Gene: ENSDARG00000042337   Transcript: ENSDART00000062080
Sequence length 114
Comment pep:known chromosome:Zv9:19:42487708:42490853:-1 gene:ENSDARG00000042337 transcript:ENSDART00000062080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEETVDQAANSRTISLPISRVRLIMKSSPDVSCINQDALFLTTKATELFVQHLALSSYEN
GPSKDTNTLSYSDLADTVEETETFQFLTDILPKKILARDYLKTLEEMEKEDDNM
Download sequence
Identical sequences Q5EAR4
7955.ENSDARP00000062079 NP_001013311.1.45394 GO.79221 ENSDARP00000062079 ENSDARP00000062079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]