SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000062268 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000062268
Domain Number 1 Region: 138-441
Classification Level Classification E-value
Superfamily Ras GEF 3.92e-84
Family Ras GEF 0.000000000266
Further Details:      
 
Domain Number 2 Region: 8-177
Classification Level Classification E-value
Superfamily Histone-fold 2.48e-54
Family TBP-associated factors, TAFs 0.00000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000062268   Gene: ENSDARG00000042468   Transcript: ENSDART00000062269
Sequence length 713
Comment pep:known chromosome:Zv9:11:45929958:46264009:1 gene:ENSDARG00000042468 transcript:ENSDART00000062269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAPPFQYDFYSEENAHKWRGLLVPSLNKVLNQVHPKLSSQQEALQYIEGLILVLLNTLC
QAQPRTVQDVEERVQRSFPHPIEKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEISQQDITVAMCADKVLMDMLHPIE
IARQLTLLESDFYRAVQPSELVGSVWTKEDKEINSPNLLRMIRHTTNLTLWLEKCIVETE
NVEERVSVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQRKILEE
AHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGTELINFSKRRK
VAEITGEIQQYQNQPYCLRVENDIRKFFENLNPMEDMMEKEFTDYLFNKSLEIEPRNART
LPRFAKKYSCPLKSPGVRPSAVRPGAMRHPTPLQNEPRKISYSRIPDSETESSAASAPNS
PRTPLTPPPASAASTDTCSVFDSPQQPSSPFHSNSECVFAPVALPHGPRSSSVSSMMGFL
RNDDPPVPPPVPPRRRPESAPAESSPSKMMSTHLDSPPAIPPRQPTSSKVYSPRYSLTDP
PESPPLLPPREPVRTPDVFCSSPLHLQPPPPGRRAPELQAFFPPQTPSPSPLGPRKHPEP
PPEPPLGPPVPPRLSTAGPPAHIPKLPPKTYKRESVHREGPPPPLLLENANPT
Download sequence
Identical sequences A2RRV5
ENSDARP00000062268 ENSDARP00000062268 NP_001076462.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]