SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000062323 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000062323
Domain Number 1 Region: 20-123
Classification Level Classification E-value
Superfamily Histone-fold 1.96e-43
Family Nucleosome core histones 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000062323   Gene: ENSDARG00000042502   Transcript: ENSDART00000062324
Sequence length 149
Comment pep:known chromosome:Zv9:10:46362731:46372778:-1 gene:ENSDARG00000042502 transcript:ENSDART00000062324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCSSLCFPSVSSEKRSSSSGEMAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKT
RTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDS
LIKATIAGGGVIPHIHKSLIGKKGQQKTV
Download sequence
Identical sequences Q7ZU59
ENSDARP00000062323 ENSDARP00000062323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]